PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 410aa    MW: 46475.9 Da    PI: 7.0848
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-51653PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.17.3e-27169222155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kprl Wt++LH++Fv av++L G +kA+P +il++m+v+ Lt ++v+SHLQkYR 
  Lsa016336 169 KPRLSWTKDLHNKFVAAVKHL-GVDKAIPTSILKVMNVENLTKQNVASHLQKYRG 222
                79*******************.********************************5 PP

2Response_reg76.97.4e-26201271108
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+ +l+k +y +v+++ ++  al++l+e++  +Dl++ D+ mp+mdG++ll++   e  +lp+i+++++g+ + +++ +  Ga 
     Lsa016336  20 VLAVDDDPACLKILEALLRKCQY-HVTTTNQAVLALQMLRENKekFDLVISDVCMPDMDGFKLLEHVGLEM-DLPVIMLSSYGDTKHVTKGIYHGAC 114
                   799********************.***************887778**********************6644.8************************ PP

                   EEEESS--HHHHH CS
  Response_reg  96 dflsKpfdpeelv 108
                   d+l Kp+ +eel 
     Lsa016336 115 DYLLKPVRIEELK 127
                   **********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.6E-4117160No hitNo description
SuperFamilySSF521724.13E-3517142IPR011006CheY-like superfamily
SMARTSM004481.7E-3018130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.49519134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2320127IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.28E-2821134No hitNo description
Gene3DG3DSA:1.10.10.604.6E-27166227IPR009057Homeodomain-like
PROSITE profilePS5129412.784166225IPR017930Myb domain
SuperFamilySSF466893.94E-18167226IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-22169221IPR006447Myb domain, plants
PfamPF002491.4E-6171221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGVEPKSANE SDEFPVGMRV LAVDDDPACL KILEALLRKC QYHVTTTNQA VLALQMLREN  60
KEKFDLVISD VCMPDMDGFK LLEHVGLEMD LPVIMLSSYG DTKHVTKGIY HGACDYLLKP  120
VRIEELKLIW QHVIRRKIGK NRLDEVENVF SDKNEKPNKR RKDSSAQKKP RLSWTKDLHN  180
KFVAAVKHLG VDKAIPTSIL KVMNVENLTK QNVASHLQKY RGYLKRISHE ENQKGNMVIS  240
PNRRLDFAYL PTFIGYENQS LGKNSYPPNN XNWXKQVLLL VWVFLVFHLY PMIQENDSQK  300
LATTINLQEA PNVVDESILY PVTQNALGNL VCPIQSSCYV SNDGFTPMGN NVEGMIPPYS  360
TTYDGGVGSL EDIAAAMMRE EKGKGKVIVE GHSGYYDEVC YATSENYIYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-23165228164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136967.11e-105hypothetical protein PHAVU_009G0889000g, partial
RefseqXP_014629984.11e-103PREDICTED: two-component response regulator ARR12-like isoform X1
RefseqXP_015884775.11e-103PREDICTED: two-component response regulator ARR12
SwissprotQ6K8X61e-100ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLV7AXK21e-105V7AXK2_PHAVU; Uncharacterized protein (Fragment)
TrEMBLI1JU861e-103I1JU86_SOYBN; Uncharacterized protein
TrEMBLA0A0S3RCH71e-103A0A0S3RCH7_PHAAN; Uncharacterized protein
STRINGGLYMA04G06650.11e-103(Glycine max)